PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G063200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family CO-like
Protein Properties Length: 391aa    MW: 40076.6 Da    PI: 6.1054
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G063200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.17.3e-0855100342
              zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                            ++C+ +e+ ++   C+ +   lC+ C   +H        H++vp+
  Sobic.004G063200.1.p  55 VWVCEVCERAPAAVTCRADAAALCAACDADIHDAnplarrHERVPV 100
                           689*****************************44788888999986 PP

2CCT70.44.4e-24296339144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpR+KGrF+k+a
  Sobic.004G063200.1.p 296 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRIKGRFAKRA 339
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0031257IPR000315B-box-type zinc finger
CDDcd000217.97E-51557No hitNo description
PROSITE profilePS5011910.86553100IPR000315B-box-type zinc finger
PfamPF006438.4E-654100IPR000315B-box-type zinc finger
SMARTSM003367.9E-958100IPR000315B-box-type zinc finger
PfamPF062039.4E-18296338IPR010402CCT domain
PROSITE profilePS5101716.926296338IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MEALVAGRYW GVGGRRCEAC GGSPAAVHCR TCPGGGAYLC AGCDAGHARA GHERVWVCEV  60
CERAPAAVTC RADAAALCAA CDADIHDANP LARRHERVPV QPIGAAAAAP AAETLLFGAA  120
AEENQDDDDG AAAAAKVVGV DAGKLADFLF ADVMDPFFGQ DFTGGTRFPH ADSVVPNKGS  180
CGGGGAVDLD FGGGVAAAAV AAKPSYSSYT AASLGHSGSS SEVGLVPDAM CGRGGSVTGG  240
VIELDFAQSK AAYLPYAATP THSMSSLDVG AVPERGDGVM AGRVATPPAA AAAESREARL  300
MRYREKRKNR RFEKTIRYAS RKAYAESRPR IKGRFAKRAD DNDADADADF DFDAGAAAAT  360
APARSRSQQQ QPSYPYVLDF AAGYGVVPTF *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.199180.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451648.10.0hypothetical protein SORBIDRAFT_04g005250
TrEMBLC5XW990.0C5XW99_SORBI; Putative uncharacterized protein Sb04g005250
STRINGSb04g005250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-16CONSTANS-like 5